PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G326500.2.p
Common NameLOC101772719, SETIT_000730mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 609aa    MW: 66004.6 Da    PI: 8.7585
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G326500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR39.98.5e-13156195242
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                         +kk CnC++s+Clk+YCeCfa+g++C+  C+C++C+N++e+
  Seita.5G326500.2.p 156 KKKCCNCRNSRCLKLYCECFASGAHCDG-CNCTNCFNNSEN 195
                         799*************************.********9985 PP

2TCR50.73.6e-16239278140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Seita.5G326500.2.p 239 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 278
                         589***********************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.3E-13155195IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.243156279IPR005172CRC domain
PfamPF036387.5E-9157192IPR005172CRC domain
SMARTSM011147.9E-20239280IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12242277IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MAGREQGGGG PPQRPPVPAA STQPPIKKLV RQLDFNSAAL AGNPAMAAAA AAVSRALQPR  60
SLPVGLQQPP QHARAAVPMG VPQQLHPRLL PVMRPHHVVG HVPLPRHAVP VAVPVPQLRP  120
VPPQPVQRPP VAVPLKPESP KPRPRLYEGK DATPTKKKCC NCRNSRCLKL YCECFASGAH  180
CDGCNCTNCF NNSENEAARR EAIDATLERN PDAFRPKIGS SPHANRNNEV SSDLPLIGKH  240
NKGCHCKKSG CLKKYCECFQ ANILCSENCK CMDCKNFEAS DERRALFQGD HKNSINMQQV  300
TNAAVNGAIG ATGFPSPSTS RKRKHIDPSL DHSNKEHVAQ RNSHLPQNAV PDGSIPISQS  360
AHPPTLGPFK VSYRPLLADI VQTEDIKDLC KLLVVVSGEA AKAYAGRKTQ EERVPEKEDE  420
RGGQKEDEKA GSLGSTNHDR EGNNQDPDHK ASIDDHSSRG THTGKAVLEE SRPNCTDDHK  480
SNRPMSPGTL ALMCDEQDTM FTTSQNAIAQ QTVAVNQNQS ELYAEQERVV LTEFRDCLRK  540
LVTFGRMKEE RYSMAIKSET SGHPGQVNGV SRVPYPKVDA PAVVKTSLQG SSSHPVAGKP  600
VTGHLDKN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672400.0BT067240.1 Zea mays full-length cDNA clone ZM_BFb0345D13 mRNA, complete cds.
GenBankHQ8586710.0HQ858671.1 Zea mays clone UT1107 CPP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970042.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
TrEMBLK3XFR10.0K3XFR1_SETIT; Uncharacterized protein
STRINGSi000730m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-121Tesmin/TSO1-like CXC domain-containing protein